PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016469440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 378aa    MW: 42912.1 Da    PI: 7.2244
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016469440.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.21.9e-15122202690
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     ++++ l+ g l+lp +fa+    ++ ++ +l ++de+ r W++kl+ + +++r+++++GW++F  +n Lk+g+ ++F+++++ ++
  XP_016469440.1 122 IRPYCLTCGYLRLPQQFANGL--SN-KKCDLFIRDERQRLWNLKLS-SDCKDRVYIGDGWRKFIADNCLKVGERIMFEVVSDGKT 202
                     6788889999*******9444..33.3348***************5.777788*************************8876443 PP

2B358.99.1e-19278357587
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     ++++++ k+ rl+l  +fa+++g+ +++  +++++de+ rsW+v+l    ++ ++ +t+GW +Fvkan++++gD++ F+l+++
  XP_016469440.1 278 TIKPYSIKRPRLYLQADFAKSNGLMNRR-CEMIITDEKQRSWSVQL--GPTGHHVAITRGWTKFVKANDVQVGDTFKFELINN 357
                     568999****************887655.59***************..****9**************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.0E-15114211IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.0E-17115211IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.984117214IPR003340B3 DNA binding domain
SMARTSM010192.7E-9117214IPR003340B3 DNA binding domain
PfamPF023621.5E-13121203IPR003340B3 DNA binding domain
CDDcd100174.86E-13125211No hitNo description
SuperFamilySSF1019361.79E-19269366IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-20269366IPR015300DNA-binding pseudobarrel domain
CDDcd100171.03E-17273367No hitNo description
PROSITE profilePS5086313.366274368IPR003340B3 DNA binding domain
SMARTSM010191.6E-14275372IPR003340B3 DNA binding domain
PfamPF023626.3E-17278357IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MLVFRHEGNM KFEVIIFDSS HCDREYAEYL QEEEAATPTA HTFGETSKNF EFKDTNNYAS  60
IPSGDRLYGS LPSMSCHLSH SGNTDDVIEI PSPDINSSDE DSSHAEAATD KHVGHSHFIC  120
TIRPYCLTCG YLRLPQQFAN GLSNKKCDLF IRDERQRLWN LKLSSDCKDR VYIGDGWRKF  180
IADNCLKVGE RIMFEVVSDG KTESTWKFHV TDAETPKQKF QDLRANASLH PEGKKPDLDA  240
NRYSTQGLRI ETSDMTAPKA QVPASTSANN AYPHFISTIK PYSIKRPRLY LQADFAKSNG  300
LMNRRCEMII TDEKQRSWSV QLGPTGHHVA ITRGWTKFVK ANDVQVGDTF KFELINNGTI  360
PIAYFHCKYS GKDTKQSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597679.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X2
RefseqXP_016469440.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X3
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.19e-19B3 family protein